Il33

  • Official Full Name

    interleukin 33
  • Overview

    IL33 (MIM 608678) is a member of the IL1 (see MIM 147760) family that potently drives production of T helper-2 (Th2)-associated cytokines (e.g., IL4; MIM 147780). IL33 is a ligand for IL33R (IL1RL1; MIM 601203), an IL1 family receptor that is selectively expressed on Th2 cells and mast cells (summary by Yagami et al., 2010 [PubMed 20926795]).[supplied by OMIM, Jan 2011]
  • Synonyms

    IL33;interleukin 33;DVS27;IL1F11;NF-HEV;NFEHEV;C9orf26;interleukin-33;IL-33;IL-1F11;DVS27-related protein;interleukin-1 family member 11;nuclear factor for high endothelial venules;nuclear factor from high endothelial venules

Recombinant Proteins

  • Canine
  • Mouse
  • Human
  • Cynomolgus
  • Rat
  • Pig
  • Dog
  • E.coli
  • CHO
  • HEK293
  • Mammalian Cells
  • Human
  • Mouse
  • Human Cells
  • Wheat Germ
  • In Vitro Cell Free System
  • Yeast
  • Insect Cells
  • Non
  • Fc
  • His
  • GST
  • Flag
  • Avi
Cat.# Product name Source (Host) Species Tag Protein Length Price
IL33-1034C Active Recombinant Canine IL33 protein E.coli Canine Non Ser110-Ser263
IL33-120M Active Recombinant Mouse Interleukin 33, MIgG2a Fc-tagged, mutant CHO Mouse Fc 118-266 a.a.
IL33-121H Active Recombinant Human Interleukin 33, MIgG2a Fc-tagged CHO Human Fc 112-270 a.a.
IL33-122H Active Recombinant Human Interleukin 33, HIgG1 Fc-tagged, mutant CHO Human Fc 112-270 a.a.
IL33-124H Active Recombinant Human Interleukin 33, HIgG1 Fc-tagged CHO Human Fc 112-270 a.a.
IL33-130M Active Recombinant Mouse Interleukin 33, MIgG2a Fc-tagged CHO Mouse Fc 118-266 a.a.
IL33-215H Active Recombinant Human IL33 protein E.coli Human Non 112-270 a.a.
Il33-358M Active Recombinant Mouse Il33, His-tagged E.coli Mouse His 109-266 a.a.
Il33-01M Active Recombinant Mouse Il33 Protein, His-Tagged E.coli Mouse His
IL33-0291C Recombinant Cynomolgus IL33 protein, His-tagged HEK293 Cynomolgus His His109-Ile270
IL33-2218H Active Recombinant Human IL33 protein, His-tagged HEK293 Human His Ser 112 - Thr 270
IL33-123H Recombinant Human Interleukin 33, HIgG1 Fc-tagged CHO Human Fc
IL33-138H Recombinant Human IL33 protein E.coli Human Non 159
Il33-2061M Recombinant Mouse Il33 protein, GST-tagged E.coli Mouse GST Ser109~Ile266
Il33-207M Recombinant Mouse Il33 protein E.coli Mouse Non 158
Il33-286R Recombinant Rat Interleukin 33 E.coli Rat Non 109-264 a.a.
IL33-29791TH Active Recombinant Human IL33 protein, FLAG-tagged HEK293 Human Flag 112-270 a.a.
IL33-3045R Recombinant Rat IL33 Protein Mammalian Cells Rat His
IL33-320H Recombinant Human Interleukin 33 E.coli Human Non
IL33-322H Recombinant Human IL33, His-tagged E.coli Human His
IL33-32H Recombinant Human IL33 protein, His-tagged E.coli Human His 112-270 a.a.
IL33-448H Recombinant Human Interleukin 33, His-tagged Human Human His 112-270 a.a.
Il33-50R Recombinant Rat Il33 protein, His-tagged E.coli Rat His
Il33-583R Recombinant Rat Il33 protein E.coli Rat Non 156
IL33-58H Recombinant Human Interleukin 33 E.coli Human Non
IL33-59H Recombinant Human IL33, His-tagged E.coli Human His 1-270 a.a.
IL33-637M Recombinant Mouse interleukin 33, His-tagged E.coli Mouse His 109-266 a.a.
IL33-5226HCL Recombinant Human IL33 293 Cell Lysate HEK293 Human Non
CAB11566MH Mouse Anti-Human Interleukin-33 Monoclonal Antibody Mouse Human Non
IL33-020H Recombinant Human interleukin 33 Protein, His tagged E.coli Human His 109-270aa
Il33-026I Active Recombinant Mouse Il33 Protein (158 aa) E.coli Mouse 158
IL33-0289M Recombinant Mouse IL33 protein, His-Avi-tagged, Biotinylated HEK293 Mouse Avi&His 109-266 a.a.
IL33-0290H Active Recombinant Human IL33 protein, His-Avi-tagged, Biotinylated HEK293 Human Avi&His 109-270 a.a.
IL33-066H Active Recombinant Human IL33 Protein E.coli Human 112-270 a.a.
IL33-095I Active Recombinant Human IL33 Protein (159 aa) E.coli Human 159
IL33-1019M Recombinant Mouse IL33 protein, His-tagged HEK293 Mouse His Ser 109 - Ile 266
IL33-110H Recombinant Human IL33 Protein E.coli Human 112-270 a.a.
IL33-151H Recombinant Human IL33 Protein, His-tagged Human Cells Human His
Il33-157M Recombinant Mouse Il33 Protein E.coli Mouse
Il33-158M Active Recombinant Mouse Il33 Protein E.coli Mouse
IL33-163M Recombinant Mouse IL33 Protein E.coli Mouse 109-266 a.a.
IL33-164C Recombinant Cynomolgus IL33 Protein E.coli Cynomolgus 112-270 a.a.
IL33-165H Recombinant Human IL33 Protein, Avi-tagged E.coli Human Avi 111-270 a.a.
IL33-166H Recombinant Human IL33 Protein E.coli Human 112-270 a.a.
Il33-1679M Recombinant Mouse Il33 Protein, His-tagged E.coli Mouse His Met1-Ile266
IL33-174H Active Recombinant Human IL33 Protein E.coli Human
IL33-175M Active Recombinant Mouse IL33 Protein E.coli Mouse
IL33-17C Recombinant Cynomolgus IL33 protein E.coli Cynomolgus Non Ser112-Ile270
IL33-1917M Recombinant Mouse IL33 Protein E.coli Mouse Non
IL33-191H Recombinant Active Human IL33 Protein, His-tagged(C-ter) E.coli Human His
Il33-192M Recombinant Active Mouse IL33 Protein, His-tagged(C-ter) E.coli Mouse His
IL33-212H Recombinant Human IL33 Protein, His-tagged E.coli Human His
IL33-218H Recombinant Human IL33 Protein, Avi-tagged E.coli Human Avi 111-270 a.a.
IL33-2221M Recombinant Mouse IL33 protein, His-tagged HEK293 Mouse His Ser 109 - Ile 266
IL33-2313H Recombinant Human IL33 Protein, His-tagged E.coli Human His Ser112-Thr270
IL33-2572H Active Recombinant Human IL33 protein E.coli Human Non Ser112-Thr270
IL33-2700R Recombinant Rat IL33 Protein, His (Fc)-Avi-tagged HEK293 Rat Avi&Fc&His
IL33-2700R-B Recombinant Rat IL33 Protein Pre-coupled Magnetic Beads HEK293 Rat
IL33-2897H Recombinant Human IL33 Protein (Ser112-Thr270), His tagged E.coli Human His Ser112-Thr270
Il33-295M Active Recombinant Mouse Il33 Protein (Ser109-Ile266), C-His tagged, Animal-free, Carrier-free E.coli Mouse His Ser109-Ile266
IL33-301497H Recombinant Human IL33 protein, GST-tagged E.coli Human GST Met109-Ile266
IL33-3103P Recombinant Pig IL33 protein, GST-tagged E.coli Pig GST 123-276aa
IL33-310H Recombinant Human IL33 protein, His-tagged HEK293 Human His His109-Thr270
IL33-312H Active Recombinant Human IL33 Protein (Ser112-Thr270), C-His tagged, Animal-free, Carrier-free E.coli Human His Ser112-Thr270
Il33-3521M Recombinant Mouse Il33 Protein E.coli Mouse Ser109-Ile266
IL33-356I Active Recombinant Human IL33 Protein (159 aa) E.coli Human 159
IL33-3829D Recombinant Dog IL33 protein(102-263aa), His-tagged HEK293 Dog His 102-263aa
IL33-4211D Recombinant Dog IL33 protein(102-263aa), His-tagged E.coli Dog His 102-263aa
IL33-4337HG Active GMP Recombinant Human IL33 protein E.coli Human Non
IL33-45H Recombinant Human IL33 Protein, N-Avi tagged, Biotinylated E.coli Human Avi S111-T270
IL33-486H Active Recombinant Human IL33 Protein E.coli Human Non
Il33-5186M Active Recombinant Mouse Il33 Protein E.coli Mouse Non 109-266 a.a.
IL33-5188H Recombinant Human IL33 Protein, GST-tagged Wheat Germ Human GST
IL33-520HFL Recombinant Full Length Human IL33 Protein, N-His-tagged E.coli Human His Full L.
IL33-5783HF Recombinant Full Length Human IL33 Protein, GST-tagged In Vitro Cell Free System Human GST Full L. 270 amino acids
IL33-578D Recombinant Dog IL33 protein, His-tagged Yeast Dog His 102-263aa
IL33-643D Recombinant Dog IL33 protein(102-263aa), His-tagged Insect Cells Dog His 102-263aa
Il33-7419M Recombinant Mouse Il33 Protein, His-tagged E.coli Mouse His 109-266
IL33-760H Recombinant Human IL33 protein, His-Avi-tagged HEK293 Human Avi&His Ser112-Thr270

    Involved Pathway

    Il33 involved in several pathways and played different roles in them. We selected most pathways Il33 participated on our site, such as Cytosolic DNA-sensing pathway,Influenza A, which may be useful for your reference. Also, other proteins which involved in the same pathway with Il33 were listed below. Creative BioMart supplied nearly all the proteins listed, you can search them on our site.

    Pathway Name Pathway Related Protein
    Influenza A TMPRSS13,AKT2,ADAR,HSPA1B,IFNA12,OAS1,NXF2,IFNAR2,IFNA7,ICAM1
    Cytosolic DNA-sensing pathway IFNA8,RIPK3,RIPK1L,IFNB1,IFI202B,POLR3H,CCL5,ADAR,IFNA6,DDX58

    Protein Function

    Il33 has several biochemical functions, for example, cytokine activity,protein binding. Some of the functions are cooperated with other proteins, some of the functions could acted by Il33 itself. We selected most functions Il33 had, and list some proteins which have the same functions with Il33. You can find most of the proteins on our site.

    Function Related Protein
    protein binding EZH2,NMI,E2F8,SKP1,NDFIP1,EIF2B2,EIF4ENIF1,NEK2,IMPA2,DACT1
    cytokine activity SCG2,CCL4,BMP8A,IL8L2,HMGB1,IL1A,HMGB1A,IFNG1-2,GDF10,IL36G

    Interacting Protein

    Il33 has direct interactions with proteins and molecules. Those interactions were detected by several methods such as yeast two hybrid, co-IP, pull-down and so on. We selected proteins and molecules interacted with Il33 here. Most of them are supplied by our site. Hope this information will be useful for your research of Il33.

    HIST1H2AG;IL1RL1;CRMP1;HIST1H2BC

    Resources

    References

    • Li, C; Mu, R; et al. Genetic variant in IL33 is associated with susceptibility to rheumatoid arthritis. ARTHRITIS RESEARCH & THERAPY 16:-(2014).
    • Tordesillas, L; Gomez-Casado, C; et al. Transport of Pru p 3 across gastrointestinal epithelium - an essential step towards the induction of food allergy?. CLINICAL AND EXPERIMENTAL ALLERGY 43:1374-1383(2013).

    Reviews

    Q&As

    Can you please provide me the AA sequence of this protein? 05/27/2024

    IL33-310H: HHHHHHHHHHGGGSGGGS-HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

    Can you please provide me the AA sequence of this protein? 05/27/2024

    IL33-124H: The extracellular domain of human IL-33 (aa 112-270) is fused to the N-terminus of the Human IgG Fc region (aa 100-330) containing the hinge sequence. Human IL-33: https://www.ncbi.nlm.nih.gov/protein/AAH47085.1 SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET Human IgG: https://www.uniprot.org/uniprotkb/P01857/entry PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPEL

    Ask a Question for All Il33 Products

    Required fields are marked with *

    My Review for All Il33 Products

    Required fields are marked with *