Active Recombinant Mouse Il33 Protein

• Cat.No.: Il33-5186M
• Product Overview: Mouse Il33 (Q8BVZ5, 109 a.a. - 266 a.a.) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 109-266 a.a.
• Description: Interleukin 33 (IL-33) is a protein that in humans is encoded by the IL33 gene. Interleukin 33 is a member of the IL-1 family that potently drives production of T helper-2 (Th2)-associated cytokines (e.g., IL-4). IL33 is a ligand for ST2 (IL1RL1), an IL-1 family receptor that is highly expressed on Th2 cells, mast cells and group 2 innate lymphocytes. IL-33 is expressed by a wide variety of cell types, including fibroblasts, mast cells, dendritic cells, macrophages, osteoblasts, endothelial cells, and epithelial cells.
• Form: Lyophilized
• Bio-activity: The ED50 was determined by the dose-dependent proliferation of murine D10S cells is ≤ 0.3 ng/mL.
• Molecular Mass: 18 kDa
• AA Sequence: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
• Endotoxin: Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg).
• Purity: > 90% by SDS-PAGE and HPLC
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from PBS, pH 7.5

Gene Information

• Gene Name: Il33 interleukin 33 [ Mus musculus ]
• Official Symbol: Il33
• Synonyms: IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik
• Gene ID: 77125
• mRNA Refseq: NM_001164724
• Protein Refseq: NP_001158196