Recombinant Human IL33 protein, His-tagged

• Cat.No.: IL33-310H
• Product Overview: Recombinant Human IL33 protein (His109-Thr270), fused to His-tag at the N-terminus, was expressed in human 293 cells (HEK293).

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: His109-Thr270
• Description: Interleukin 33 (IL33) is known as C9orf26, DKFZp586H0523, DVS27, NF-HEV, NFEHEV, RP11-575C20.2,and is a cytokine belonging to the IL-1 superfamily. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 mediates its biological effects by interacting with the receptors ST2 (aka IL1RL1) and IL-1 Receptor Accessory Protein (IL1RAP), activating intracellular molecules in the NF-κB and MAP kinase signaling pathways that drive production of type 2 cytokines (e.g. IL-5 and IL-13) from polarized Th2 cells. In vivo, IL-33 induces the expression of IL-4, IL-5, and IL-13 and leads to severe pathological changes in mucosal organs.
• Predicted N Terminal: His
• Form: Lyophilized from 0.22 μm filtered solution in PBS, pH7.4, 10% trehalose.
• Molecular Mass: The protein has a calculated MW of 20.2 kDa. The protein migrates as 25-30 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation.
• Endotoxin: Less than 1.0 EU per μg by the LAL method.
• Purity: >95% as determined by SDS-PAGE.
• Storage: For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower.
  Please avoid repeated freeze-thaw cycles.
  This product is stable after storage at:
  -20 to -70 centigrade for 12 months in lyophilized state;
  -70 centigrade for 3 months under sterile conditions after reconstitution.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 mg/ml. Centrifuge the vial at 4℃ before opening to recover the entire contents.

Gene Information

• Gene Name: IL33
• Official Symbol: IL33
• Synonyms: DVS27; IL1F11; NF-HEV; NFEHEV; C9orf26
• Gene ID: 90865
• mRNA Refseq: NM_001314044.2
• Protein Refseq: NP_001300973.1
• MIM: 608678
• UniProt ID: O95760

Q&As

Can you please provide me the AA sequence of this protein?

IL33-310H: HHHHHHHHHHGGGSGGGS-HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET