Recombinant Mouse Il33 Protein, His-tagged

• Cat.No.: Il33-7419M
• Product Overview: Recombinant mouse IL33 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 109-266
• Description: In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
• Form: Liquid
• Molecular Mass: 18.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate buffered saline, 10 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Il33 interleukin 33 [ Mus musculus (house mouse) ]
• Official Symbol: Il33
• Synonyms: Il33; interleukin 33; Il-; Il1f; NF-H; Il-33; Il1f11; NF-HEV; 9230117N10Rik; interleukin-33; nuclear factor from high endothelial venules
• Gene ID: 77125
• mRNA Refseq: NM_001164724
• Protein Refseq: NP_001158196
• UniProt ID: Q8BVZ5