Recombinant Mouse Il33 Protein, His-tagged
Cat.No. : | Il33-7419M |
Product Overview : | Recombinant mouse IL33 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 109-266 |
Description : | In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation. |
Form : | Liquid |
Molecular Mass : | 18.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate buffered saline, 10 % glycerol, 1 mM DTT. |
Gene Name | Il33 interleukin 33 [ Mus musculus (house mouse) ] |
Official Symbol | Il33 |
Synonyms | Il33; interleukin 33; Il-; Il1f; NF-H; Il-33; Il1f11; NF-HEV; 9230117N10Rik; interleukin-33; nuclear factor from high endothelial venules |
Gene ID | 77125 |
mRNA Refseq | NM_001164724 |
Protein Refseq | NP_001158196 |
UniProt ID | Q8BVZ5 |
◆ Recombinant Proteins | ||
IL33-3045R | Recombinant Rat IL33 Protein | +Inquiry |
IL33-191H | Recombinant Active Human IL33 Protein, His-tagged(C-ter) | +Inquiry |
IL33-4211D | Recombinant Dog IL33 protein(102-263aa), His-tagged | +Inquiry |
IL33-1917M | Recombinant Mouse IL33 Protein | +Inquiry |
IL33-59H | Recombinant Human IL33, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *
0
Inquiry Basket