Recombinant Human Interleukin 33

• Cat.No.: IL33-58H
• Product Overview: Recombinant Human Interleukin33 produced inE.Coliis a single, non-glycosylated, polypeptide chain containing 160 amino acids and having a molecular mass of 18 kDa. The IL-33 is purified by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Interleukin 33 (IL-33) is a 32kDa proinflammatory cytokine that may also regulate gene transcription in producer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1 (IL1 receptor-like-1), which is known also as ST2. Binding of IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces expression of IL-4, IL-5, IL-13 and leads to severe pathological changes in mucosal organs and in vitro, it can be divided to N-terminal fragment of 12kDa and C-terminal fragment of 18kDa by cleavage of caspase-1.
• Amino Acid Sequence: MSITGISPITEYL ASLSTYNDQSIT FALEDESYEIYV EDLKKDEKKD KVLLSYYESQH PSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNM HSNCVSF EC KTDPGVFIGVKDNHLALI KVDSSENLCT ENILFKLSET.
• Physical Appearance: Sterile Filtered colorless liquid at a concentration of 1 mg/ml.
• Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Formulation: The protein is formulated in 20mM Tris pH-8.
• Biological Activity: The ED50 as determined by the dose-dependant stimulation of TF-1 cells is < 0.1 ng/ml, corresponding to a Specific Activity of 1 x 10⁷IU/mg.
• Storage: IL-33 although stable at 14°Cfor 1 week, should be stored desiccated below -18°C. Upon arrival IL33 Recombinant should be stored at 4°Cbetween 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Gene Information

• Gene Name: IL33 interleukin 33 [ Homo sapiens ]
• Synonyms: IL33; interleukin 33; DVS27; NF-HEV; NFEHEV; C9orf26; DKFZp586H0523; RP11-575C20.2; DVS27-related protein; nuclear factor from high endothelial venules; chromosome 9 open reading frame 26 (NF-HEV); IL-1F11; IL-33; IL1F11; NFHEV; OTTHUMP00000021041; Interleukin-1 family member 11; Nuclear factor from high endothelial venules
• Gene ID: 90865
• mRNA Refseq: NM_033439
• Protein Refseq: NP_254274
• MIM: 608678
• UniProt ID: O95760
• Chromosome Location: 9p24.1
• Function: cytokine activity; protein binding