Recombinant Human Interleukin 33
Cat.No. : | IL33-58H |
Product Overview : | Recombinant Human Interleukin33 produced inE.Coliis a single, non-glycosylated, polypeptide chain containing 160 amino acids and having a molecular mass of 18 kDa. The IL-33 is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Interleukin 33 (IL-33) is a 32kDa proinflammatory cytokine that may also regulate gene transcription in producer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1 (IL1 receptor-like-1), which is known also as ST2. Binding of IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces expression of IL-4, IL-5, IL-13 and leads to severe pathological changes in mucosal organs and in vitro, it can be divided to N-terminal fragment of 12kDa and C-terminal fragment of 18kDa by cleavage of caspase-1. |
Amino Acid Sequence : | MSITGISPITEYL ASLSTYNDQSIT FALEDESYEIYV EDLKKDEKKD KVLLSYYESQH PSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNM HSNCVSF EC KTDPGVFIGVKDNHLALI KVDSSENLCT ENILFKLSET. |
Physical Appearance : | Sterile Filtered colorless liquid at a concentration of 1 mg/ml. |
Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Formulation : | The protein is formulated in 20mM Tris pH-8. |
Biological Activity : | The ED50 as determined by the dose-dependant stimulation of TF-1 cells is < 0.1 ng/ml, corresponding to a Specific Activity of 1 x 107IU/mg. |
Storage : | IL-33 although stable at 14°Cfor 1 week, should be stored desiccated below -18°C. Upon arrival IL33 Recombinant should be stored at 4°Cbetween 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | IL33 interleukin 33 [ Homo sapiens ] |
Synonyms | IL33; interleukin 33; DVS27; NF-HEV; NFEHEV; C9orf26; DKFZp586H0523; RP11-575C20.2; DVS27-related protein; nuclear factor from high endothelial venules; chromosome 9 open reading frame 26 (NF-HEV); IL-1F11; IL-33; IL1F11; NFHEV; OTTHUMP00000021041; Interleukin-1 family member 11; Nuclear factor from high endothelial venules |
Gene ID | 90865 |
mRNA Refseq | NM_033439 |
Protein Refseq | NP_254274 |
MIM | 608678 |
UniProt ID | O95760 |
Chromosome Location | 9p24.1 |
Function | cytokine activity; protein binding |
◆ Recombinant Proteins | ||
IL33-165H | Recombinant Human IL33 Protein, Avi-tagged | +Inquiry |
IL33-3045R | Recombinant Rat IL33 Protein | +Inquiry |
IL33-760H | Recombinant Human IL33 protein, His-Avi-tagged | +Inquiry |
IL33-122H | Active Recombinant Human Interleukin 33, HIgG1 Fc-tagged, mutant | +Inquiry |
IL33-2218H | Active Recombinant Human IL33 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *
0
Inquiry Basket