Recombinant Rat Il33 protein

• Cat.No.: Il33-583R
• Product Overview: Recombinant Rat Il33 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 156
• Description: Interleukin-33 (IL-33), also known as NF-HEV and DVS 27, is a cytokine belonging to the IL-1 superfamily. It is also a proinflammatory protein that may regulate gene transcription and it induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. The induction of type 2 cytokines by IL-33 in vivo is believed to induce the severe pathological changes observed in mucosal organs following administration of IL-33. IL-33 is constitutively expressed in smooth muscle and airway epithelia and it binds to a high-affinity receptor family member ST2. In vivo administration of mature IL-33 promotes increased production of IL-5, IL-13, IgE, and IgA, as well as splenomegaly and inflammatory infiltration of mucosal tissues. Recombinant rat IL-3 contains 156 amino acid residues and it shares 59 % a.a. and 90 % sequence identity with human and murine IL-33.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 300 mM NaCl, pH 8.5.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 17.4 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
• AA Sequence: SIQGTSLLTESCALSTYNDQSVSFVLENGCYVINVEDCGKNQEKDKVLLRYYESSFPAQSGDGVDGKKLMVNMSPIKDTDIWLNANDKDYSVELQKGDVSPPDQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEENDESCNNIMFKLSKM
• Endotoxin: Less than 1 EU/µg of rRtIL-33 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il33
• Official Symbol: Il33
• Synonyms: IL-33
• Gene ID: 361749
• mRNA Refseq: NM_001014166
• Protein Refseq: NP_001014188
• UniProt ID: Q66H70