Recombinant Mouse Il33 protein
Cat.No. : | Il33-207M |
Product Overview : | Recombinant Mouse Il33 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 158 |
Description : | IL-33 is a number of IL-1 superfamily, secreted by high endothelial venules at high levels, which is found in tonsils, peyer patches and mesenteric lymph nodes, but not in placenta. It elicits its biological effects by interacting with IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Mature IL-33 share approximately 55 % and 90 % a.a. sequence identity with human and rat IL-33 respectively. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, and 1 mM EDTA. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 17.5 kDa protein containing 158 amino acid residues. |
AA Sequence : | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Endotoxin : | Less than 1 EU/µg of rMuIL-33 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il33 |
Official Symbol | Il33 |
Synonyms | IL-1F11, NF-HEV |
Gene ID | 77125 |
mRNA Refseq | NM_001164724 |
Protein Refseq | NP_001158196 |
UniProt ID | Q8BVZ5 |
◆ Recombinant Proteins | ||
IL33-191H | Recombinant Active Human IL33 Protein, His-tagged(C-ter) | +Inquiry |
IL33-29791TH | Active Recombinant Human IL33 protein, FLAG-tagged | +Inquiry |
IL33-1019M | Recombinant Mouse IL33 protein, His-tagged | +Inquiry |
IL33-120M | Active Recombinant Mouse Interleukin 33, MIgG2a Fc-tagged, mutant | +Inquiry |
IL33-58H | Recombinant Human Interleukin 33 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *
0
Inquiry Basket