Recombinant Pig IL33 protein, GST-tagged
Cat.No. : | IL33-3103P |
Product Overview : | Recombinant Pig IL33 protein(M5B263)(123-276aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | GST |
Protein Length : | 123-276aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
IL33-45H | Recombinant Human IL33 Protein, N-Avi tagged, Biotinylated | +Inquiry |
IL33-1019M | Recombinant Mouse IL33 protein, His-tagged | +Inquiry |
IL33-130M | Active Recombinant Mouse Interleukin 33, MIgG2a Fc-tagged | +Inquiry |
IL33-121H | Active Recombinant Human Interleukin 33, MIgG2a Fc-tagged | +Inquiry |
Il33-158M | Active Recombinant Mouse Il33 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *
0
Inquiry Basket