Active Recombinant Human IL33 Protein

• Cat.No.: IL33-174H
• Product Overview: Recombinant Human IL33 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Interleukin 33 (IL-33) is a member of the IL-1 cytokine family and is constitutively expressed in smooth muscle and airway epithelial cells. IL-33 signals through the interleukin 1 receptor-like 1 (IL-1R1) and interleukin-1 receptor accessory protein (IL1RAP) receptors to ativate NF-κB and MAPK signaling pathways. IL-33 functions to induce type 2 cytokine production in polarized Type 2 helper T (Th2) cells.
• Bio-activity: D10S cell proliferation, ≤500 pg/mL; ≥2.0 x 10^6 units/mg
• Molecular Mass: Monomer, 18.1 kDa (160 aa)
• AA Sequence: MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: IL33 interleukin 33 [ Homo sapiens (human) ]
• Official Symbol: IL33
• Synonyms: IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2
• Gene ID: 90865
• mRNA Refseq: NM_001199640
• Protein Refseq: NP_001186569
• MIM: 608678
• UniProt ID: O95760