Recombinant Dog IL33 protein(102-263aa), His-tagged
Cat.No. : | IL33-3829D |
Product Overview : | Recombinant Dog IL33 protein(O97863)(102-263aa), fused with N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | HEK293 |
Tag : | His |
Protein Length : | 102-263aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS |
Gene Name | IL33 interleukin 33 [ Canis lupus familiaris ] |
Official Symbol | IL33 |
Synonyms | IL33; interleukin 33; interleukin-33; IL-33; DVS27; |
Gene ID | 403810 |
mRNA Refseq | NM_001003180 |
Protein Refseq | NP_001003180 |
◆ Recombinant Proteins | ||
IL33-122H | Active Recombinant Human Interleukin 33, HIgG1 Fc-tagged, mutant | +Inquiry |
IL33-2700R | Recombinant Rat IL33 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL33-29791TH | Active Recombinant Human IL33 protein, FLAG-tagged | +Inquiry |
IL33-2313H | Recombinant Human IL33 Protein, His-tagged | +Inquiry |
Il33-50R | Recombinant Rat Il33 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *
0
Inquiry Basket