Active Recombinant Mouse Il33 Protein (158 aa)

• Cat.No.: Il33-026I
• Product Overview: Recombinant Mouse Il33 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 158
• Description: IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is ≤ 0.5 ng/mL, corresponding to a specific activity of ≥ 2 × 10^6units/mg.
• Molecular Mass: Approximately 17.5 kDa protein containing 158 amino acid residues
• AA Sequence: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
• Endotoxin: Less than 1 EU/mg of rmIL-33 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered solution in PBS, EDTA and DTT.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il33 interleukin 33 [ Mus musculus ]
• Official Symbol: Il33
• Synonyms: IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik
• Gene ID: 77125
• mRNA Refseq: NM_001164724
• Protein Refseq: NP_001158196
• UniProt ID: Q8BVZ5