Recombinant Human IL33 protein

Cat.No. : IL33-138H
Product Overview : Recombinant Human IL33 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 159
Description : IL-33, encoded by IL-33 gene located on the Chr.9 in humans, is a 30 kDa proinflammatory protein belonging to the IL-1 superfamily and it shares less than 20 % a.a. sequence identity with other members. IL-33 secreted by high endothelial venules at high levels, which is found in tonsils, peyer patches and mesenteric lymph nodes, but not in placenta. It is upregulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL1α or IL1β stimulation. It elicits its biological effects by interacting with IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL-33 mature protein has 52-58 % a.a. sequence identity with mouse and rat IL-33.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, 150 mM NaCl, 1mM EDTA, pH7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids.
AA Sequence : SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Endotoxin : Less than 1 EU/µg of rHuIL-33 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL33
Official Symbol IL33
Synonyms IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2;
Gene ID 90865
mRNA Refseq NM_001199640
Protein Refseq NP_001186569
MIM 608678
UniProt ID O95760

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL33 Products

Required fields are marked with *

My Review for All IL33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon