Recombinant Mouse Il33 Protein

• Cat.No.: Il33-157M
• Product Overview: Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 1 without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
• Molecular Mass: 17.6 kDa
• AA Sequence: MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI*
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Il33 interleukin 33 [ Mus musculus (house mouse) ]
• Official Symbol: Il33
• Synonyms: Il33; interleukin 33; Il-33; Il1f11; NF-HEV; 9230117N10Rik; interleukin-33; nuclear factor from high endothelial venules
• Gene ID: 77125
• mRNA Refseq: NM_001164724
• Protein Refseq: NP_001158196
• UniProt ID: Q8BVZ5