Active Recombinant Mouse Il33 Protein, His-Tagged
Cat.No. : | Il33-01M |
Product Overview : | Recombinant mouse Il33 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 33 (IL-33) is a member of the IL-1 family that potently drives production of T helper-2 (Th2)-associated cytokines (e.g., IL-4). IL33 is a ligand for ST2 (IL1RL1), an IL-1 family receptor that is highly expressed on Th2 cells, mast cells and group 2 innate lymphocytes. It is expressed by a wide variety of cell types, including fibroblasts, mast cells, dendritic cells, macrophages, osteoblasts, endothelial cells, and epithelial cells. |
Form : | Lyophilized powder |
AA Sequence : | MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHAND KDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is > 2 x 10^7 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il33 interleukin 33 [ Mus musculus (house mouse) ] |
Official Symbol | Il33 |
Synonyms | Il-33; Il1f11; NF-HEV; 9230117N10Rik |
Gene ID | 77125 |
mRNA Refseq | NM_001164724.2 |
Protein Refseq | NP_001158196.1 |
UniProt ID | Q8BVZ5 |
◆ Recombinant Proteins | ||
IL33-320H | Recombinant Human Interleukin 33 | +Inquiry |
IL33-191H | Recombinant Active Human IL33 Protein, His-tagged(C-ter) | +Inquiry |
Il33-1679M | Recombinant Mouse Il33 Protein, His-tagged | +Inquiry |
IL33-130M | Active Recombinant Mouse Interleukin 33, MIgG2a Fc-tagged | +Inquiry |
IL33-163M | Recombinant Mouse IL33 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *
0
Inquiry Basket