Active Recombinant Human IL33 Protein (159 aa)
Cat.No. : | IL33-356I |
Product Overview : | Recombinant humanInterleukin-33 (rhIL-33) produced in E. coli is a single non-glycosylated polypeptide chain containing 159 amino acids. A fully biologically active molecule, rhIL-33 has a molecular mass of 18.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 159 |
Description : | Interleukin-33 (IL-33) is a proinflammatory cytokine that belongs to the IL-1 family. IL-33 is expressed in a variety of cells, including epithelial and endothelial cells, smooth muscle cells, macrophages and fibroblasts. The primary receptors for IL-33 are ST2 and IL-1 receptor accessory protein (IL-1RAcP), both of which belong to the IL-1 receptor family. IL-33 is localized to the nucleus of resting cells where it binds to chromatin in the H2A-H2B histone complex as a transcriptional suppressor. IL-33 is secreted by cells during injury which induces a T-helper 2 type inflammatory response. Evidence suggests IL-33 plays a role in autoimmune disease. IL-33's interaction with ST2 can drive allergic pathology and IL-33 has been reported to play a role in the development of rheumatoid arthritis and systemic lupus erythematosus. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 ng/mL, measured by a cell proliferation assay using D10S cells, corresponding to a specific activity of > 2 × 10^6 units/mg. |
Molecular Mass : | 18.0 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGEanalysis. |
Storage : | Lyophilized recombinant human Interleukin-33 (rhIL-33) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-33 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | IL33 interleukin 33 [ Homo sapiens ] |
Official Symbol | IL33 |
Synonyms | IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2; |
Gene ID | 90865 |
mRNA Refseq | NM_001199640 |
Protein Refseq | NP_001186569 |
MIM | 608678 |
UniProt ID | O95760 |
◆ Recombinant Proteins | ||
Il33-192M | Recombinant Active Mouse IL33 Protein, His-tagged(C-ter) | +Inquiry |
IL33-0291C | Recombinant Cynomolgus IL33 protein, His-tagged | +Inquiry |
IL33-637M | Recombinant Mouse interleukin 33, His-tagged | +Inquiry |
IL33-3045R | Recombinant Rat IL33 Protein | +Inquiry |
IL33-1034C | Active Recombinant Canine IL33 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *
0
Inquiry Basket