Active Recombinant Human IL33 Protein (159 aa)

• Cat.No.: IL33-356I
• Product Overview: Recombinant humanInterleukin-33 (rhIL-33) produced in E. coli is a single non-glycosylated polypeptide chain containing 159 amino acids. A fully biologically active molecule, rhIL-33 has a molecular mass of 18.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 159
• Description: Interleukin-33 (IL-33) is a proinflammatory cytokine that belongs to the IL-1 family. IL-33 is expressed in a variety of cells, including epithelial and endothelial cells, smooth muscle cells, macrophages and fibroblasts. The primary receptors for IL-33 are ST2 and IL-1 receptor accessory protein (IL-1RAcP), both of which belong to the IL-1 receptor family. IL-33 is localized to the nucleus of resting cells where it binds to chromatin in the H2A-H2B histone complex as a transcriptional suppressor. IL-33 is secreted by cells during injury which induces a T-helper 2 type inflammatory response. Evidence suggests IL-33 plays a role in autoimmune disease. IL-33's interaction with ST2 can drive allergic pathology and IL-33 has been reported to play a role in the development of rheumatoid arthritis and systemic lupus erythematosus.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 ng/mL, measured by a cell proliferation assay using D10S cells, corresponding to a specific activity of > 2 × 10^6 units/mg.
• Molecular Mass: 18.0 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGEanalysis.
• Storage: Lyophilized recombinant human Interleukin-33 (rhIL-33) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-33 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: IL33 interleukin 33 [ Homo sapiens ]
• Official Symbol: IL33
• Synonyms: IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2
• Gene ID: 90865
• mRNA Refseq: NM_001199640
• Protein Refseq: NP_001186569
• MIM: 608678
• UniProt ID: O95760