Recombinant Active Mouse IL33 Protein, His-tagged(C-ter)

• Cat.No.: Il33-192M
• Product Overview: Recombinant Active Mouse IL33 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]
• Form: Powder
• Bio-activity: Determined by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is < 40 pg/ml. The specific activity of recombinant mouse IL-33 is > 2 x 10^7 IU/mg.
• AA Sequence: MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Il33 interleukin 33 [ Mus musculus ]
• Official Symbol: Il33
• Synonyms: IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik
• Gene ID: 77125
• mRNA Refseq: NM_001164724
• Protein Refseq: NP_001158196