Recombinant P. grandiflora 4,5-DOPA dioxygenase extradiol Protein, His-SUMO/MYC-tagged
| Cat.No. : | DODA-1190P |
| Product Overview : | Recombinant Portulaca grandiflora 4,5-DOPA dioxygenase extradiol Protein (1-271aa) was expressed in E. coli with N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | P.grandiflora |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| ProteinLength : | 1-271 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 49.9 kDa |
| AA Sequence : | MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRTWDHGTLGYASYKFTSI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | 4,5-DOPA dioxygenase extradiol |
| Official Symbol | 4,5-DOPA dioxygenase extradiol |
| Synonyms | 4,5-DOPA dioxygenase extradiol; DODA; dioxygenase extradiol; EC 1.13.11.29; EC=1.13.11.29; 1.13.11.29; Q7XA48 |
| UniProt ID | Q7XA48 |
| ◆ Recombinant Proteins | ||
| EMR3-3293H | Recombinant Human EMR3 Protein | +Inquiry |
| CD207-5607H | Active Recombinant Human CD207 Molecule, Langerin, His-tagged | +Inquiry |
| RFL15322AF | Recombinant Full Length Agrobacterium Vitis Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged | +Inquiry |
| SCN4B-5267R | Recombinant Rat SCN4B Protein | +Inquiry |
| CHEK1-629H | Recombinant Human CHEK1 | +Inquiry |
| ◆ Native Proteins | ||
| ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
| NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
| FGF2-26551TH | Native Human FGF2 | +Inquiry |
| Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
| GFAP-526H | Native Human GFAP protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYT9-1301HCL | Recombinant Human SYT9 293 Cell Lysate | +Inquiry |
| C17orf81-8227HCL | Recombinant Human C17orf81 293 Cell Lysate | +Inquiry |
| IFI27L1-5295HCL | Recombinant Human IFI27L1 293 Cell Lysate | +Inquiry |
| HA-2365HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
| PEMT-3300HCL | Recombinant Human PEMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All 4,5-DOPA dioxygenase extradiol Products
Required fields are marked with *
My Review for All 4,5-DOPA dioxygenase extradiol Products
Required fields are marked with *
0
Inquiry Basket
