Recombinant Full Length Agrobacterium Vitis Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL15322AF |
Product Overview : | Recombinant Full Length Agrobacterium vitis Apolipoprotein N-acyltransferase(lnt) Protein (B9JZJ6) (1-528aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium vitis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-528) |
Form : | Lyophilized powder |
AA Sequence : | MERLAARIMLLAGWRRALLAIASGAVGALALPPVGFFAALFFSFSMLVWLLDGVSGNPDR SWSRGLRSAFWIGWLFGFGYFVAGLWWLGNALMVEADEFAWALPLAVLGLPAVLAVFYGL ACLAARLLWSEGLGRIAALAAMFGITEWLRSFIATGFPWNAIGYGAMPIPLMMQSAAVLG LFGVSALAVFVFAAPALLGTRRGAKLGLALAGILFCGHLGYGAYRLSLPEPDGRKVTVRL VQPNIDQAAKMDDTDRVAIFEKHLRLTAVPTPADQPRPDVIVWPETTIPFILTENPDALR QIAGALQEGQVLITGTVRSEDQGAGIAPRYYNSIYAIDSQGQILAAADKVHLVPFGEYVP WQDILSKLGITNIIDLPGGFSQGASRSLMTLPGGLKLYPLICYEVIFPDEMVKGLSGANA IINVTNDAWFGDTPGPFQHFQQARLRAVETGLPIIRAANNGISALIDGRGRVFSGLRLNA EGVENATFTLSAAPETNVNHNKCNFWAVTALLLSAAVISRLGLISRVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; Avi_0442; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | B9JZJ6 |
◆ Recombinant Proteins | ||
RFL21829PF | Recombinant Full Length Pseudomonas Fluorescens Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
KMT2B-56H | Recombinant Human KMT2B, GST-tagged | +Inquiry |
RTCB-1924H | Recombinant Human RTCB Protein, His (Fc)-Avi-tagged | +Inquiry |
PIANP-520H | Recombinant Human PIANP Protein, Fc-tagged | +Inquiry |
MED30-4839C | Recombinant Chicken MED30 | +Inquiry |
◆ Native Proteins | ||
RB5200-3281H | Native Human RB5200 | +Inquiry |
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
HB-45R | Native Simian Hemoglobin (HB) Protein | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRICKLE1-2871HCL | Recombinant Human PRICKLE1 293 Cell Lysate | +Inquiry |
ARHGAP19-8742HCL | Recombinant Human ARHGAP19 293 Cell Lysate | +Inquiry |
FAM9A-6335HCL | Recombinant Human FAM9A 293 Cell Lysate | +Inquiry |
CNGA1-7412HCL | Recombinant Human CNGA1 293 Cell Lysate | +Inquiry |
ZFP82-177HCL | Recombinant Human ZFP82 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket