Recombinant Human RAD51B protein, T7/His-tagged

Cat.No. : RAD51B-121H
Product Overview : Recombinant human RAD51B (383aa, Isoform-I, derived from BC030219) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag fusion at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Product Overview : Recombinant human RAD51B (383aa, Isoform-I, derived from BC030219) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag fusion at C-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYR GVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMS ILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEE EIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQAD LVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQET TFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIFLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro RAD51B mediated double-stranded DNA repair pathway regulation study by intracellular delivery of this protein.2. May be used for RAD51B protein-protein interaction mapping.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) ralted enzyme functional screening assays.4. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Protein length : 383 a.a.
Gene Name RAD51B RAD51 homolog B (S. cerevisiae) [ Homo sapiens ]
Official Symbol RAD51B
Synonyms RAD51B; RAD51 homolog B (S. cerevisiae); RAD51 (S. cerevisiae) like 1 , RAD51 like 1 (S. cerevisiae) , RAD51L1; DNA repair protein RAD51 homolog 2; hREC2; R51H2; REC2; RecA-like protein; recombination repair protein; RAD51L1; MGC34245;
Gene ID 5890
mRNA Refseq NM_002877
Protein Refseq NP_002868
MIM 602948
UniProt ID O15315
Chromosome Location 14q23-q24.2
Pathway Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem;
Function ATP binding; DNA binding; DNA-dependent ATPase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAD51B Products

Required fields are marked with *

My Review for All RAD51B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon