Recombinant HPV-6a E5 Protein
Cat.No. : | VAng-Wyb3388 |
Product Overview : | Recombinant HPV-6a E5 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPV6a |
Source : | E.coli |
Tag : | Non |
Form : | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilization is 50μl/vial. |
Molecular Mass : | The protein has a calculated MW of 17.8 kDa. |
AA Sequence : | MEVVPVQIAAGTTSTLILPVIIAFVVCFVSIILIVWISDFIVYTSVLVLTLLLYLLLWLLLTTPLQFFLLTLLVCYCPALYIHHYIVNTQQ |
Purity : | >=85 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
VAng-Wyb3012 | Recombinant HPV-11 E7 Protein | +Inquiry |
VAng-Wyb3388 | Recombinant HPV-6a E5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VAng Products
Required fields are marked with *
My Review for All VAng Products
Required fields are marked with *
0
Inquiry Basket