Recombinant Human ST3GAL3 Protein (29-375 aa), His-SUMO-tagged

• Cat.No.: ST3GAL3-1002H
• Product Overview: Recombinant Human ST3GAL3 Protein (29-375 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 29-375 aa
• Description: Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 54.9 kDa
• AA Sequence: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens ]
• Official Symbol: ST3GAL3
• Synonyms: ST3GAL3; ST3N; MRT12; SIAT6; ST3GALII; ST3GalIII
• Gene ID: 6487
• mRNA Refseq: NM_006279
• Protein Refseq: NP_006270
• MIM: 606494
• UniProt ID: Q11203