Recombinant Human ST3GAL3 Protein (29-375 aa), His-SUMO-tagged
| Cat.No. : | ST3GAL3-1002H |
| Product Overview : | Recombinant Human ST3GAL3 Protein (29-375 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc. |
| Source : | E. coli |
| Species : | Human |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 54.9 kDa |
| Protein length : | 29-375 aa |
| AA Sequence : | KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens ] |
| Official Symbol | ST3GAL3 |
| Synonyms | ST3GAL3; ST3N; MRT12; SIAT6; ST3GALII; ST3GalIII; |
| Gene ID | 6487 |
| mRNA Refseq | NM_006279 |
| Protein Refseq | NP_006270 |
| MIM | 606494 |
| UniProt ID | Q11203 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ST3GAL3 Products
Required fields are marked with *
My Review for All ST3GAL3 Products
Required fields are marked with *
0
Inquiry Basket
