Recombinant Human ST3GAL3, GST-tagged

• Cat.No.: ST3GAL3-233H
• Product Overview: Recombinant Human ST3GAL3 (75 a.a. - 174 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with autosomal recessive nonsymdromic mental retardation-12 (MRT12). Multiple transcript variants encoding several different isoforms have been found for this gene.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: ATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLT PALDSLRCRRCIIVGNGGVLANKSL
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ]
• Official Symbol: ST3GAL3
• Synonyms: ST3GAL3; ST3N; MRT12; SIAT6; EIEE15; ST3GALII; ST3GalIII; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); NP_001257388.1; NP_001257389.1; NP_001257390.1; NP_001257391.1; NP_001257392.1; NP_001257393.1; NP_001257394.1; EC 2.4.99.6; NP_001257395.1; NP_006270.1; NP_777623.2; NP_777624.1; NP_777625.1; NP_777626.1; NP_777627.1; NP_777628.2; NP_777629.1; NP_777630.1; NP_777631.2
• Gene ID: 6487
• mRNA Refseq: NM_006279
• Protein Refseq: NP_006270
• MIM: 606494
• UniProt ID: Q11203
• Chromosome Location: 1p34.1
• Pathway: Glycosaminoglycan biosynthesis - keratan sulfate; Glycosphingolipid biosynthesis - lacto and neolacto series; MPS I - Hurler syndrome
• Function: N-acetyllactosaminide alpha-2,3-sialyltransferase activity; beta-galactoside (CMP) alpha-2,3-sialyltransferase activity