Recombinant Human ST3GAL3, His-tagged

• Cat.No.: ST3GAL3-232H
• Product Overview: Human ST3GAL3 partial(aa 218 to 359) was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with autosomal recessive nonsymdromic mental retardation-12 (MRT12). Multiple transcript variants encoding several different isoforms have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Lyophilised
• Protein length: 218 to 359
• AA Sequence: QDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILN PYFIQEAAF TLIGLPFNNGLMGRGNIPTLGSVAVTMAL HGCDEVAVAGFGYDMSTPNA PLHYYETVRMAAIKESWT HNIQREKEFLRKLVKARVITDLSSGI
• Applications: Mass Spectrometry; SDS-PAGE
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
• Concentration: Reconstitution Dependent
• Preservative: None
• Reconstitution: Reconstitute with 63 µl aqua dest.

Gene Information

• Gene Name: ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ]
• Official Symbol: ST3GAL3
• Synonyms: ST3GAL3; ST3N; MRT12; SIAT6; EIEE15; ST3GALII; ST3GalIII; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); NP_001257388.1; NP_001257389.1; NP_001257390.1; NP_001257391.1; NP_001257392.1; NP_001257393.1; NP_001257394.1; EC 2.4.99.6; NP_001257395.1; NP_006270.1; NP_777623.2; NP_777624.1; NP_777625.1; NP_777626.1; NP_777627.1; NP_777628.2; NP_777629.1; NP_777630.1; NP_777631.2
• Gene ID: 6487
• mRNA Refseq: NM_006279
• Protein Refseq: NP_006270
• MIM: 606494
• UniProt ID: Q11203
• Chromosome Location: 1p34.1
• Pathway: Glycosaminoglycan biosynthesis - keratan sulfate; Glycosphingolipid biosynthesis - lacto and neolacto series; MPS I - Hurler syndrome
• Function: N-acetyllactosaminide alpha-2,3-sialyltransferase activity; beta-galactoside (CMP) alpha-2,3-sialyltransferase activity