Recombinant Human ST3GAL3, GST-tagged
Cat.No. : | ST3GAL3-234H |
Product Overview : | Recombinant Human ST3GAL3 (1 a.a. - 390 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with autosomal recessive nonsymdromic mental retardation-12 (MRT12). Multiple transcript variants encoding several different isoforms have been found for this gene. |
Molecular Mass : | 70.2 kDa |
AA Sequence : | MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSSKYSHSSSPQEKPVADSVVLSFDSAGQTLGSEYDRL GFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNL IKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYP EGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLI GLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLR KLVKARVITDLSSGI |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ] |
Official Symbol | ST3GAL3 |
Synonyms | ST3GAL3; ST3N; MRT12; SIAT6; EIEE15; ST3GALII; ST3GalIII; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); NP_001257388.1; NP_001257389.1; NP_001257390.1; NP_001257391.1; NP_001257392.1; NP_001257393.1; NP_001257394.1; EC 2.4.99.6; NP_001257395.1; NP_006270.1; NP_777623.2; NP_777624.1; NP_777625.1; NP_777626.1; NP_777627.1; NP_777628.2; NP_777629.1; NP_777630.1; NP_777631.2 |
Gene ID | 6487 |
mRNA Refseq | NM_174964 |
Protein Refseq | NP_777624 |
MIM | 606494 |
UniProt ID | Q11203 |
Chromosome Location | 1p34.1 |
Pathway | Glycosaminoglycan biosynthesis - keratan sulfate; Glycosphingolipid biosynthesis - lacto and neolacto series; MPS I - Hurler syndrome |
Function | N-acetyllactosaminide alpha-2,3-sialyltransferase activity; beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
◆ Recombinant Proteins | ||
ST3GAL3-5506C | Recombinant Chicken ST3GAL3 | +Inquiry |
RFL509MF | Recombinant Full Length Mouse Cmp-N-Acetylneuraminate-Beta-1,4-Galactoside Alpha-2,3-Sialyltransferase(St3Gal3) Protein, His-Tagged | +Inquiry |
ST3GAL3-5427R | Recombinant Rat ST3GAL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ST3GAL3-8760M | Recombinant Mouse ST3GAL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ST3GAL3-5505C | Recombinant Chicken ST3GAL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST3GAL3-1441HCL | Recombinant Human ST3GAL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ST3GAL3 Products
Required fields are marked with *
My Review for All ST3GAL3 Products
Required fields are marked with *
0
Inquiry Basket