Recombinant Mouse PCSK5 Protein (117-452 aa), His-SUMO-tagged
Cat.No. : | PCSK5-711M |
Product Overview : | Recombinant Mouse PCSK5 Protein (117-452 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 117-452 aa |
Description : | Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 52.7 kDa |
AA Sequence : | DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Pcsk5 proprotein convertase subtilisin/kexin type 5 [ Mus musculus ] |
Official Symbol | PCSK5 |
Synonyms | PCSK5; PC5; PC6; PC5A; SPC6; PC5/6A; |
Gene ID | 18552 |
mRNA Refseq | NM_001163144 |
Protein Refseq | NP_001156616 |
UniProt ID | Q04592 |
◆ Recombinant Proteins | ||
PCSK5-711M | Recombinant Mouse PCSK5 Protein (117-452 aa), His-SUMO-tagged | +Inquiry |
PCSK5-30549TH | Recombinant Human PCSK5 protein, GST-tagged | +Inquiry |
PCSK5-4823H | Recombinant Human PCSK5 Protein (Asp115-Met454), N-His tagged | +Inquiry |
PCSK5-122H | Recombinant Human PCSK5, His-tagged | +Inquiry |
PCSK5-121H | Recombinant Human PCSK5, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK5-3370HCL | Recombinant Human PCSK5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCSK5 Products
Required fields are marked with *
My Review for All PCSK5 Products
Required fields are marked with *
0
Inquiry Basket