Recombinant Human PCSK5 protein, GST-tagged

• Cat.No.: PCSK5-30549TH
• Product Overview: Recombinant Human PCSK5(804 a.a. - 913 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDATE ESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 804-913 a.a.

Gene Information

• Gene Name: PCSK5 proprotein convertase subtilisin/kexin type 5 [ Homo sapiens ]
• Official Symbol: PCSK5
• Synonyms: PCSK5; proprotein convertase subtilisin/kexin type 5; PC5; PC6; SPC6; hPC6; protease PC6; prohormone convertase 5; proprotein convertase 6; subtilisin/kexin-like protease PC5; PC6A; FLJ11149; FLJ16215
• Gene ID: 5125
• mRNA Refseq: NM_006200
• Protein Refseq: NP_006191
• MIM: 600488
• UniProt ID: Q92824
• Chromosome Location: 9q21.3
• Pathway: NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signalling by NGF, organism-specific biosystem
• Function: peptidase activity; peptide binding; serine-type endopeptidase activity; serine-type endopeptidase activity; serine-type endopeptidase activity