Recombinant Mouse ASGR2 Protein (80-301 aa), His-Myc-tagged

Cat.No. : ASGR2-2450M
Product Overview : Recombinant Mouse ASGR2 Protein (80-301 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 80-301 aa
Description : Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 29.9 kDa
AA Sequence : QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Asgr2 asialoglycoprotein receptor 2 [ Mus musculus ]
Official Symbol ASGR2
Synonyms ASGR2; HL-2; mHL-2; ASGPR 2; ASGP-R 2; hepatic lectin 2; Asgr; ASGPR2; Asgr-2;
Gene ID 11890
mRNA Refseq NM_007493
Protein Refseq NP_031519
UniProt ID P24721

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASGR2 Products

Required fields are marked with *

My Review for All ASGR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon