Recombinant Human OSM, StrepII-tagged
Cat.No. : | OSM-259H |
Product Overview : | Purified, full-length human recombinant OSM or Oncostatin-M protein (amino acids 26-220, 195 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22 kDa. (Accession NP_065391.1; UniProt P13725) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 26-220, 195 a.a. |
Description : | Oncostatin M (OSM) is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQD LERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQ ALRKGVRRTRPSRKGKRLMTRGQLPR |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | OSM oncostatin M [ Homo sapiens ] |
Official Symbol | OSM |
Synonyms | OSM; oncostatin M; oncostatin-M; MGC20461; |
Gene ID | 5008 |
mRNA Refseq | NM_020530 |
Protein Refseq | NP_065391 |
MIM | 165095 |
UniProt ID | P13725 |
Chromosome Location | 22q12.2 |
Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine activity; growth factor activity; oncostatin-M receptor binding; |
◆ Recombinant Proteins | ||
OSM-3073R | Recombinant Rhesus Macaque OSM Protein, His (Fc)-Avi-tagged | +Inquiry |
Osm-5782R | Recombinant Rat Osm protein, His-tagged | +Inquiry |
OSM-4337B | Recombinant Bovine OSM Protein | +Inquiry |
OSM-31H | Recombinant Human OSM Protein | +Inquiry |
OSM-522H | Recombinant Human OSM Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
0
Inquiry Basket