Recombinant Human OSM, StrepII-tagged

• Cat.No.: OSM-259H
• Product Overview: Purified, full-length human recombinant OSM or Oncostatin-M protein (amino acids 26-220, 195 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22 kDa. (Accession NP_065391.1; UniProt P13725)

Specification

• Description: Oncostatin M (OSM) is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 26-220, 195 a.a.
• AA Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQD LERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQ ALRKGVRRTRPSRKGKRLMTRGQLPR
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: OSM oncostatin M [ Homo sapiens ]
• Official Symbol: OSM
• Synonyms: OSM; oncostatin M; oncostatin-M; MGC20461
• Gene ID: 5008
• mRNA Refseq: NM_020530
• Protein Refseq: NP_065391
• MIM: 165095
• UniProt ID: P13725
• Chromosome Location: 22q12.2
• Pathway: Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine activity; growth factor activity; oncostatin-M receptor binding