Recombinant Rhesus Monkey OSM Protein, His tagged
Cat.No. : | Osm-3256R |
Product Overview : | Recombinant Rhesus Monkey OSM Protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus Monkey |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-252 aa |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 20mM Tris, 0.5M NaCl, 50% Glycerol, pH8.0 |
AA Sequence : | MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPRHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Concentration : | 0.6 mg/mL by BCA |
Official Symbol | OSM |
Synonyms | OSM; oncostatin M; oncostatin-M |
Gene ID | 717994 |
mRNA Refseq | NM_001194474 |
Protein Refseq | NP_001181403 |
UniProt ID | F7GF43 |
◆ Recombinant Proteins | ||
OSM-463H | Recombinant Human OSM protein, His-tagged | +Inquiry |
OSM-4773H | Recombinant Human OSM Protein (Ala26-Arg221), His tagged | +Inquiry |
OSM-962H | Recombinant Human OSM protein | +Inquiry |
OSM-4337B | Recombinant Bovine OSM Protein | +Inquiry |
OSM-1472H | Recombinant Human OSM, His-tagged | +Inquiry |
◆ Native Proteins | ||
Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
0
Inquiry Basket