Recombinant Rat Osm protein, His-tagged
Cat.No. : | Osm-4527R |
Product Overview : | Recombinant Rat Osm protein(Q65Z15)(26-208aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-208aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Osm oncostatin M [ Rattus norvegicus ] |
Official Symbol | Osm |
Synonyms | OSM; oncostatin M; |
Gene ID | 114841 |
◆ Recombinant Proteins | ||
Osm-5214M | Recombinant Mouse Osm protein | +Inquiry |
Osm-168O | Active Recombinant Mouse Osm Protein | +Inquiry |
OSM-322O | Active Recombinant Human OSM Protein (210 aa) | +Inquiry |
OSM-3073R | Recombinant Rhesus Macaque OSM Protein, His (Fc)-Avi-tagged | +Inquiry |
Osm-4527R | Recombinant Rat Osm protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Osm Products
Required fields are marked with *
My Review for All Osm Products
Required fields are marked with *
0
Inquiry Basket