Active Recombinant Mouse Osm Protein (182 aa)

• Cat.No.: Osm-320O
• Product Overview: Recombinant Mouse Oncostatin M (rmOSM) produced in E. coli is a single non-glycosylated polypeptide chain containing 182 amino acids. A fully biologically active molecule, rmOSM has a molecular mass of 20.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Description: Oncostatin M (OSM) is a multifunctional cytokine, and belongs to Interleukin-6 (IL-6) subfamily, which also includes IL-11, leukemia inhibitory factor (LIF), ciliary neurotropic factor, cardiotrophin-1, and novel neurotropin-1. In vivo, OSM is secreted from activated T cells, monocytes, neutrophils, and endothelial cells. OSM is related to LIF, and shares a receptor with LIF in human. Human OSM can bind to gp130 and recruit OSM Receptor β or LIF Receptor β to form a ternary complex. OSM stimulates the growth of different types of cells, including megakaryocytes, fibroblasts, vascular endothelial cells, and T cells. OSM inhibits the proliferation of several cancer cell lines, such as solid tissue tumor cells, lung cancer cells, melanoma cells, and breast cancer cells.
• Source: E. coli
• Species: Mouse
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 ng/mL, measured by a cell proliferation assay using Rat Embryo Brain cells, corresponding to a specific activity of > 1 × 10^5 units/mg.
• Molecular Mass: 20.5 kDa, observed by reducing SDS-PAGE.
• Protein length: 182
• AA Sequence: MNRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Mouse Oncostatin M (rmOSM) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmOSM remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Osm oncostatin M [ Mus musculus ]
• Official Symbol: Osm
• Synonyms: OSM; oncostatin M; oncostatin-M; OncoM
• Gene ID: 18413
• mRNA Refseq: NM_001013365
• Protein Refseq: NP_001013383
• UniProt ID: P53347