Recombinant Human ESM1 protein, T7/His-tagged

• Cat.No.: ESM1-57H
• Product Overview: Recombinant human ESM1 gene cDNA (19 - 184aa, Isoform-I, derived from BC011989) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFWSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETC YRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVT KSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro ESM1 mediated endothelial cell differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as EMS1 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. Potential biomarker protein for cancer diagnosis, such as for human lung cancer and renal clear cell carcinoma. MSE1 may also be a potential parameter to monitor the tumor response to anti-angiogenic5. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
• Protein length: 19-184 a.a.

Gene Information

• Gene Name: ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
• Official Symbol: ESM1
• Synonyms: ESM1; endothelial cell-specific molecule 1; ESM-1; endocan
• Gene ID: 11082
• mRNA Refseq: NM_001135604
• Protein Refseq: NP_001129076
• MIM: 601521
• UniProt ID: Q9NQ30
• Chromosome Location: 5q11
• Function: growth factor activity; insulin-like growth factor binding