Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged
Cat.No. : | ESM1-902H |
Product Overview : | Recombinant Human ESM1 encoding the human mature ESM1 (Trp20-Arg184) with 6 His tag on the N-Terminus was expressed inE. Coli. This protein was purified by Ni-NTA column.MW=20KDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-184 a.a. |
Description : | Endothelial cell-specific molecule 1 is a protein that in humans is encoded by the ESM1 gene. This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. |
Sequence : | Human mature ESM1 (Trp20-Arg184)20WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR184. |
Purity : | >95% in SDS gel. |
Formulation : | Lyophilized 100 μg humanmature ESM1 in 50 μl of TBS (20 mM Tris, 50mM NaCl, pH8.0). Carry free. |
Application : | Cell biology, ELISA. |
Reconstitution : | Add 500 μl deionized water to the vial to prepare a working stock solution at 200 μg/mL. Allow to set at least 30 minutes at 4°C, mix well. |
Storage : | Store lyophilized protein at -20°C or -70°C. Lyophilized protein is stable for up to 6 months from date of receipt at -70°C. Upon reconstitution, this protein can be stored at for a few weeks or at -70°C in a manual defrost freezer for long term storage (six months). Aliquot reconstituted protein to avoid repeated freezing / thawing cycles. |
Gene Name | ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ] |
Synonyms | ESM1; endothelial cell-specific molecule 1; endocan;ESM-1 secretory protein; ESM-1 |
Gene ID | 11082 |
mRNA Refseq | NM_001135604 |
Protein Refseq | NP_001129076 |
MIM | 601521 |
UniProt ID | Q9NQ30 |
Chromosome Location | 5q11 |
Function | growth factor activity; insulin-like growth factor binding; protein binding |
◆ Recombinant Proteins | ||
Esm1-709R | Recombinant Rat Esm1 Protein, His-tagged | +Inquiry |
Esm1-707M | Recombinant Mouse Cebpd Protein, His/MBP-tagged | +Inquiry |
ESM1-7082H | Recombinant Human ESM1, His-tagged | +Inquiry |
ESM1-456H | Recombinant Human ESM1 Protein, His-tagged | +Inquiry |
Esm1-708M | Recombinant Mouse Cebpd Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESM1 Products
Required fields are marked with *
My Review for All ESM1 Products
Required fields are marked with *
0
Inquiry Basket