Recombinant Full Length Human ESM1 Protein, GST-tagged

• Cat.No.: ESM1-4707HF
• Product Overview: Human ESM1 full-length ORF ( NP_008967.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.5 kDa
• Protein length: 184 amino acids
• AA Sequence: MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
• Official Symbol: ESM1
• Synonyms: ESM1; endothelial cell-specific molecule 1; ESM-1; endocan
• Gene ID: 11082
• mRNA Refseq: NM_001135604
• Protein Refseq: NP_001129076
• MIM: 601521
• UniProt ID: Q9NQ30