Recombinant Human DST Protein, GST-tagged

Cat.No. : DST-2893H
Product Overview : Human DST partial ORF ( NP_899236, 401 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been reported that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. [provided by RefSeq, Mar 2010]
Molecular Mass : 36.74 kDa
AA Sequence : EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DST dystonin [ Homo sapiens ]
Official Symbol DST
Synonyms DST; dystonin; BPAG1, bullous pemphigoid antigen 1, 230/240kDa; bullous pemphigoid antigen 1; BP240; BPA; CATX 15; FLJ13425; FLJ21489; FLJ30627; FLJ32235; KIAA0728; MACF2; trabeculin-beta; dystonia musculorum protein; hemidesmosomal plaque protein; 230/240 kDa bullous pemphigoid antigen; bullous pemphigoid antigen 1, 230/240kDa; DT; DMH; BPAG1; CATX15; CATX-15; D6S1101; FLJ46791; KIAA0465; KIAA1470; DKFZp564B2416;
Gene ID 667
mRNA Refseq NM_001723
Protein Refseq NP_001714
MIM 113810
UniProt ID Q03001

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DST Products

Required fields are marked with *

My Review for All DST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon