Recombinant Human DST Protein, GST-tagged
Cat.No. : | DST-2893H |
Product Overview : | Human DST partial ORF ( NP_899236, 401 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been reported that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. [provided by RefSeq, Mar 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DST dystonin [ Homo sapiens ] |
Official Symbol | DST |
Synonyms | DST; dystonin; BPAG1, bullous pemphigoid antigen 1, 230/240kDa; bullous pemphigoid antigen 1; BP240; BPA; CATX 15; FLJ13425; FLJ21489; FLJ30627; FLJ32235; KIAA0728; MACF2; trabeculin-beta; dystonia musculorum protein; hemidesmosomal plaque protein; 230/240 kDa bullous pemphigoid antigen; bullous pemphigoid antigen 1, 230/240kDa; DT; DMH; BPAG1; CATX15; CATX-15; D6S1101; FLJ46791; KIAA0465; KIAA1470; DKFZp564B2416; |
Gene ID | 667 |
mRNA Refseq | NM_001723 |
Protein Refseq | NP_001714 |
MIM | 113810 |
UniProt ID | Q03001 |
◆ Recombinant Proteins | ||
DST-688H | Recombinant Human DST Protein, His-tagged | +Inquiry |
DST-1693H | Recombinant Human DST Protein (1-195 aa), His-tagged | +Inquiry |
DST-2208H | Recombinant Human DST Protein (Met1-Trp979), N-His tagged | +Inquiry |
DST-26933TH | Recombinant Human DST | +Inquiry |
DST-301443H | Recombinant Human DST protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DST Products
Required fields are marked with *
My Review for All DST Products
Required fields are marked with *
0
Inquiry Basket