Recombinant Human DST protein, GST-tagged

Cat.No. : DST-301443H
Product Overview : Recombinant Human DST (420-610 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ser420-Asp610
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
AA Sequence : SGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name DST dystonin [ Homo sapiens ]
Official Symbol DST
Synonyms DST; dystonin; BPAG1, bullous pemphigoid antigen 1, 230/240kDa; bullous pemphigoid antigen 1; BP240; BPA; CATX 15; FLJ13425; FLJ21489; FLJ30627; FLJ32235; KIAA0728; MACF2; trabeculin-beta; dystonia musculorum protein; hemidesmosomal plaque protein; 230/240 kDa bullous pemphigoid antigen; bullous pemphigoid antigen 1, 230/240kDa; DT; DMH; BPAG1; CATX15; CATX-15; D6S1101; FLJ46791; KIAA0465; KIAA1470; DKFZp564B2416;
Gene ID 667
mRNA Refseq NM_001723
Protein Refseq NP_001714
MIM 113810
UniProt ID Q03001

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DST Products

Required fields are marked with *

My Review for All DST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon