Recombinant Full Length Yarrowia Lipolytica Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL4048YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Formation of crista junctions protein 1(FCJ1) Protein (Q6C060) (18-563aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-563) |
Form : | Lyophilized powder |
AA Sequence : | STASRLQQAAKPATGSTVGTANGASAASGKPPGATFEGASKQKKKTHKFRNFVLLSTFVG AGAFAGGVYYSLQNDQFQSLFVEYVPAAEHAINYIEEQQLRSGRLKIATPTSKHDVDQST VRVPKSGATWRAVDSTDAATSAKSASSPAANVAKDVASPAPAATASPVSSGSPKTDNTTV PAVRLANDSDPAVKAAVQTFNDLIAVAPSGAAKQLSAKVSTVVDQLQHNVAQIKSEAAEE AKNSINKLNSELAKLKASTGEEISSKVSAAEQQLRNEFAALRAHSEKVYHDRLRVEIEAT KSLVSSHANNLIQAVEAERQKQYAQEIAERVETEREGRLSKLKDLQTSLTQLQDLALKTE QAVDASGRTAALHLAIAKLTGALKGSEPVALGPYVESIRRAAGDDPLLQAALDSIPEVAQ TEGVLTPAQLTIRFKLLEPELRKSSLVPVNAGVAGHLGSLIFSSLLFKKSGVPKGDDVES VLARANIALEQGKLYDAVAEVNTLKGWPRKLASDWLDEGRRRTEIEFLADVIAEEGKLYG ALSSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; YALI0F27555g; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | Q6C060 |
◆ Recombinant Proteins | ||
GM2A-2972H | Recombinant Human GM2A protein, His-SUMO-tagged | +Inquiry |
SYNJ2BP-5147C | Recombinant Chicken SYNJ2BP | +Inquiry |
RFL30200MF | Recombinant Full Length Moorella Thermoacetica Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
ELNB-4446Z | Recombinant Zebrafish ELNB | +Inquiry |
YQBC-3077B | Recombinant Bacillus subtilis YQBC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
IgG-147R | Native Rabbit IgG Fab fragment | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAR-9025HCL | Recombinant Human ADAR 293 Cell Lysate | +Inquiry |
Skin-57H | Human Skin Tumor Tissue Lysate | +Inquiry |
P2RX6-3496HCL | Recombinant Human P2RX6 293 Cell Lysate | +Inquiry |
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
TUBB3-648HCL | Recombinant Human TUBB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket