Recombinant Full Length Lachancea Thermotolerans Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL18319LF |
Product Overview : | Recombinant Full Length Lachancea thermotolerans Formation of crista junctions protein 1(FCJ1) Protein (C5E325) (25-527aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lachancea thermotolerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-527) |
Form : | Lyophilized powder |
AA Sequence : | ATFEGQPAARPNRLSKLLVRVGLATVGFYVGGVTLSLNNDQFGELFCDNVPLAESLVEMY EEFRDEKMQASRMSLDELKQKFGELGTKVDRIPNRGADPALTSQAVAALPASKEVRLEDE SLVKLRLPEVEQLGSCKRATPLVESVNAAVAAVNEQSLLLPEDTYNAVHDAFTKLKSALQ AINEDIRTNVAESVAVQYGQASKDLHESFEIRAKSREVELTQQFLNEFNAFKAQLEKHSS EELASALKANEQALLAKQSNEVALLSMKQVEEFTKILSEKLDQERQGRLSKLEALNGSVQ ELAEAVDQVDTLVMKSEVLSQLSLLTTLLKNKLHAGDESSVKIDSELARLKTLCDILPGR PSKCCSKNPQLLDVVVSQLDSLASQQLILSNEQLYNRWTLLQKDLSTSSLLPPNAGILGH ISAKIFGFFLFNKNGAPVDNDIDSVIARVGQNLRLSKLDKAVEEVVALKGWPRVLCDEWV QEARKKLEIETLIDALDCEIRSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; KLTH0H09724g; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C5E325 |
◆ Recombinant Proteins | ||
PLAUR-725H | Recombinant Human PLAUR Protein (23-305 aa), GST-tagged | +Inquiry |
env-166H | Recombinant HIV (IIIB) env protein, β-gal-tagged | +Inquiry |
CTSBB-6198Z | Recombinant Zebrafish CTSBB | +Inquiry |
DDI1-453C | Recombinant Cynomolgus DDI1 Protein, His-tagged | +Inquiry |
SPRY4-8690M | Recombinant Mouse SPRY4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
AFP-3017H | Native Human fetal cord serum | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
C2-98H | Active Native Human C2 Protein | +Inquiry |
HSV2Ag-355H | Active Native Herpes Simplex Virus 2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IgG3-1606MCL | Recombinant Mouse IgG3 cell lysate | +Inquiry |
Pituitary-383H | Human Pituitary Membrane Lysate | +Inquiry |
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
C1orf87-228HCL | Recombinant Human C1orf87 cell lysate | +Inquiry |
Skeletal Muscle-112M | Mouse Skeletal Muscle Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket