Recombinant Full Length Penicillium Chrysogenum Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL35116PF |
Product Overview : | Recombinant Full Length Penicillium chrysogenum Formation of crista junctions protein 1(fcj1) Protein (B6H457) (62-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Penicillium rubens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (62-646) |
Form : | Lyophilized powder |
AA Sequence : | ADSKPPTTGGPTPVSPSSESSVPPETISKAAEQESKLPPSPPAAAPRKSGRFRRFLIYLI LTSGFAYGGSIFLALKFDNFHDFFTEYIPYGEESVLYFEERDFYRRFPNALRHPNRLPAA PREEGKPVTIPSKSGLSWKVAEEQKADADSKKAEAAHEGQIKPAAAKPEERNAAVVKAKE DTASKHSTKEAKPESEAKSPVSLDEPRKPAVSASTIELLQLQDGDDTVVQDLVKTFNDIV TVISADENSNKYSAPVAKAKGELEKIAEKIAAIRSEARNTAQEELNKLHATFDESARELM RQFEEVRSTDLASFREEFEAEREKLALAYQQKVNTELRHAQELAEQRLQNELVEQAIELN RKYVHEVKSLVEREREGRLSKLTELTADVNELEKLTAGWSDVIDANLKTQQLQVALDAVR TVVERAETPRPFIRELVAVKELAAGDAVVEAAIASINPTAYQRGIPSTTQIFERFRRVAS EVRKASLLPEDAGVASHAASLVLSKVMFKKDALSEGDDVESVLVRTENLLQQGDVDAAAR EMNTLQGWAKILSKDWLGDVRKVLEVRQALEVIEAEARLQCLRVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; Pc13g07690; MICOS complex subunit mic60; Mitofilin |
UniProt ID | B6H457 |
◆ Recombinant Proteins | ||
CA13-0235H | Recombinant Human CA13 Protein, GST-Tagged | +Inquiry |
CD40LG-102HB | Recombinant Human CD40LG protein, His-Flag-tagged, Biotinylated | +Inquiry |
BPGM-6654H | Recombinant Human BPGM protein, His-tagged | +Inquiry |
SCNN1A-7976H | Recombinant Human SCNN1A protein, His & T7-tagged | +Inquiry |
PDZD9-778C | Recombinant Cynomolgus PDZD9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
gG2-650V | Native Herpes Simplex Virus gG2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Brain-44H | Hamster Brain Lysate | +Inquiry |
GPR162-742HCL | Recombinant Human GPR162 cell lysate | +Inquiry |
CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
MTNR1A-4071HCL | Recombinant Human MTNR1A 293 Cell Lysate | +Inquiry |
Heart-826M | Mini pig Heart Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket