Recombinant Full Length Saccharomyces Cerevisiae Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL35202SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Formation of crista junctions protein 1(FCJ1) Protein (P36112) (18-540aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-540) |
Form : | Lyophilized powder |
AA Sequence : | ASINTGTTVASKKASHKFRNTLWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDL LETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNI ETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEAL SNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKAN EELLQAKHANEVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSS KILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGD CCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLL ADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLND AVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; AIM28; FCJ1; FMP13; YKR016W; MICOS complex subunit MIC60; Altered inheritance of mitochondria protein 28; Formation of crista junctions protein 1; Found in mitochondrial proteome protein 13; Mitofilin |
UniProt ID | P36112 |
◆ Native Proteins | ||
IgM-210R | Native Rabbit IgM | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
Factor D-61H | Native Human Factor D | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-470C | Cynomolgus monkey Spleen Lysate | +Inquiry |
GPSM3-5764HCL | Recombinant Human GPSM3 293 Cell Lysate | +Inquiry |
FGFR1-476HCL | Recombinant Human FGFR1 cell lysate | +Inquiry |
CD19-2005HCL | Recombinant Human CD19 cell lysate | +Inquiry |
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket