Recombinant Full Length Saccharomyces Cerevisiae Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL36201SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Formation of crista junctions protein 1(FCJ1) Protein (B3LRA0) (17-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-539) |
Form : | Lyophilized powder |
AA Sequence : | ASINTGTTVASKKASHKFRNTFWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDL LETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNI ETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEAL SNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKAN EELLQAKHANEVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSS KILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGD CCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLL ADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLND AVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; SCRG_04035; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | B3LRA0 |
◆ Recombinant Proteins | ||
ERI3-2851M | Recombinant Mouse ERI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMP1-77H | Recombinant Human TIMP1, His-tagged | +Inquiry |
RFC3-1423C | Recombinant Chicken RFC3 | +Inquiry |
GAPDH-2940C | Recombinant Chinese hamster GAPDH protein, His-tagged | +Inquiry |
PPARG-0777H | Recombinant Human PPARG Protein (P234-Y505), Tag Free | +Inquiry |
◆ Native Proteins | ||
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF1-2760HCL | Recombinant Human SLAMF1 cell lysate | +Inquiry |
RFXAP-1496HCL | Recombinant Human RFXAP cell lysate | +Inquiry |
DNMT3B-6854HCL | Recombinant Human DNMT3B 293 Cell Lysate | +Inquiry |
Colon-750B | Bovine Colon Membrane Lysate, Total Protein | +Inquiry |
ADI1-9011HCL | Recombinant Human ADI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket