Recombinant Full Length Xanthomonas Axonopodis Pv. Citri Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL2262XF |
Product Overview : | Recombinant Full Length Xanthomonas axonopodis pv. citri Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q8PKS5) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas axonopodis pv. citri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MTISIDRPAPVSSWRTYRRLLAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGVAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAVKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAQLLQAADQTLSSHQEVKIYGAQQTEMERYGALANR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGTVPLTRAKGLIEFRDVTARYPGQVN PALADVSFVAQPGTVTAIVGRSGSGKSSLIKLIPRFYEAEAGQILLDGHPVQAYALADLR RQIALVGQQVMLFDGSIADNVAFGEMRNADAGKLERAILGANAMEFVAQLPEGLQSHVGT KGGRLSGGQRQRLAIARAMLKDAPVLILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHQLLAQGGLYSHLHGMQFRERQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; XAC2087; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q8PKS5 |
◆ Recombinant Proteins | ||
CD68-0842H | Recombinant Human CD68 Protein, GST-Tagged | +Inquiry |
EGFR-4753H | Recombinant Human Epidermal Growth Factor Receptor, His-tagged | +Inquiry |
CSTA-226H | Recombinant Human CSTA protein(Ile2-Phe98), His-tagged | +Inquiry |
BEND6-3920H | Recombinant Human BEND6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSH3-494H | Recombinant Human MSH3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
DD-49H | Native Human FDP-D-Monomer | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A & IL12B-1780MCL | Recombinant Mouse IL12A & IL12B Overexpression Lysate(Met 1-Ala 215&Met 1-Ser 335) | +Inquiry |
TLL2-1048HCL | Recombinant Human TLL2 293 Cell Lysate | +Inquiry |
MTUS1-426HCL | Recombinant Human MTUS1 lysate | +Inquiry |
PARP8-1285HCL | Recombinant Human PARP8 cell lysate | +Inquiry |
FERMT2-6262HCL | Recombinant Human FERMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket