Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL35573WF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q8D2U8) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Wigglesworthia glossinidia brevipalpis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MLKKNFSTWRIFCRLWPIISPFKSGLIISIVALIINATSDTLMLSLLKPLLDNGFKSSEN KISIWMPLAIVALMLSRGSSGFISSYFISWVSGKVVMNIRRNLFRHMMNMPVSFFDKRST GALLSRITYDTEQVASSSSSVLITIVREGSLIIGLFFMMFFHSWKLSSVLIIITPIVFFS INQVSKRFRKINKKIQNNMGQVNFIVEQMLKGHKEIRIFGGQKEEIDRFNYVSNFIRQQS MKIVISSSTLDIIIQFISSITLAVILYISSLPKIIDELTAGTITVIFTSMIALMRPLKSL TNVNANFQKGMVACKTLFSIFDIKQEQDIGKCYINRARGEIKFKNITFTYPGKENPSLKD INIKISAGCTVALIGSSGAGKSTIVNLLTRFYEADKGSIFLDNINLKKYKLSNLRNQIAL VSQNIYLFNDTIANNIAYAKKKIYSKYQIEKAAYMAYAMDFIIKMKHGLNTIIGENGTLL SGGQRQRIAIARALLRDCPILILDEATSALDIESEIKVQKAIDKIRKNRTSLVIAHRIST IKKSDMILLVEKGKIIEYGNHNELIEKKGVYAQIYRLQLDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; WIGBR2540; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q8D2U8 |
◆ Recombinant Proteins | ||
YHAM-0161B | Recombinant Bacillus subtilis YHAM protein, His-tagged | +Inquiry |
PLS3-3295R | Recombinant Rhesus Macaque PLS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP1-3684C | Recombinant Chicken DUSP1 | +Inquiry |
PRSS35-3457R | Recombinant Rhesus Macaque PRSS35 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA1C-14917M | Recombinant Mouse SERPINA1C Protein | +Inquiry |
◆ Native Proteins | ||
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEK-1707RCL | Recombinant Rat TEK cell lysate | +Inquiry |
ECT2-6728HCL | Recombinant Human ECT2 293 Cell Lysate | +Inquiry |
SMAD4-1676HCL | Recombinant Human SMAD4 293 Cell Lysate | +Inquiry |
IL7R-959RCL | Recombinant Rat IL7R cell lysate | +Inquiry |
SOX7-1556HCL | Recombinant Human SOX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket