Recombinant Full Length Haemophilus Ducreyi Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL28857HF |
Product Overview : | Recombinant Full Length Haemophilus ducreyi Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q7VL52) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus ducreyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MQETDLSIIKTFKRLFPIIRNYKWGLIAASVALILNALVDSSLIYLLKPLLDDGFGKADN AFLKQMAILVMLFILLRGVSNYIASYCLSWVSGKVVMTLRRNIFQHLMYMPVSYFDKNPT GRLLSRVTYDTEMVASSSSYVLVTIVREGAYLISLFAVMVYTSWQLSIVLFLLAPIIAFL ISIVSKRFRILSRNIQNSMGELTVTTEQMLKGHKVVLSFGGQKVEKARFDRVSNDMRRKG MKIVSADGISDGLVQLIASLALSAVLYVATFPEVMSENLTAGSFTVVFSSMMAMLRPLKS LTSVNSQFQRGMAACQTLFEFLDLKTEKNNGTKQVERAQGCITFDNVIFSYEGKEEQALN QVSFTIPQGKTVALVGRSGSGKSTIASLLTRFYDVNEGQILLDGVNIEEYTLENLREQCS VVSQQVHLFNDTIANNIAYAAKDKYSRAQIIAAAQAAHAMEFIEKLEQGLDTVIGENGAS LSGGQRQRLAIARALLRNAPVLVLDEATSALDTESELAIQSALAALQKNKTVLVIAHRLS TIEKADEILVVDQGKIVERGSHEQLLAKGGAYKQLYSMQFSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; HD_1630; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q7VL52 |
◆ Recombinant Proteins | ||
TNNC2-2912H | Recombinant Human TNNC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL35566CF | Recombinant Full Length Transmembrane Protein 33 Homolog(Y37D8A.17) Protein, His-Tagged | +Inquiry |
BAX-094H | Recombinant Human BAX Protein, GST-tagged | +Inquiry |
POMCB-5367Z | Recombinant Zebrafish POMCB | +Inquiry |
RFL29828SF | Recombinant Full Length Salmonella Arizonae Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
Complement C3a-46H | Native Human Complement C3a | +Inquiry |
Collagen-58M | Native Mouse Collagen Type II | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
◆ Cell & Tissue Lysates | ||
IQCD-5179HCL | Recombinant Human IQCD 293 Cell Lysate | +Inquiry |
Spleen-469B | Bovine Spleen Lysate | +Inquiry |
CASQ2-7826HCL | Recombinant Human CASQ2 293 Cell Lysate | +Inquiry |
CCDC22-7773HCL | Recombinant Human CCDC22 293 Cell Lysate | +Inquiry |
ZBTB37-215HCL | Recombinant Human ZBTB37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket