Recombinant Full Length Escherichia Coli Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL5869EF |
Product Overview : | Recombinant Full Length Escherichia coli Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (P60752) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; b0914; JW0897; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA; Lipid flippase |
UniProt ID | P60752 |
◆ Recombinant Proteins | ||
ICAM3-6858HF | Recombinant Full Length Human ICAM3 Protein | +Inquiry |
HSH2D-5096H | Recombinant Human HSH2D Protein, GST-tagged | +Inquiry |
RFL5528EF | Recombinant Full Length Escherichia Coli O81 Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
MAPKAP1-6389C | Recombinant Chicken MAPKAP1 | +Inquiry |
PREPL-3416R | Recombinant Rhesus Macaque PREPL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
KLK4-238H | Native Human Kallikrein | +Inquiry |
HP-146R | Native Rabbit Hemoglobin | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTAP10-4-4856HCL | Recombinant Human KRTAP10 293 Cell Lysate | +Inquiry |
EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
NXPH4-1241HCL | Recombinant Human NXPH4 cell lysate | +Inquiry |
PRMT8-2837HCL | Recombinant Human PRMT8 293 Cell Lysate | +Inquiry |
HMGN2P46-8270HCL | Recombinant Human C15orf21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket