Recombinant Full Length Nitrosococcus Oceani Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL583NF |
Product Overview : | Recombinant Full Length Nitrosococcus oceani Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q3J7R8) (1-597aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nitrosococcus oceani |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-597) |
Form : | Lyophilized powder |
AA Sequence : | MTFTPSLNSGLAVYRRLLSYTRPYRWIFAASIITMAIYAATETGLAALMKPLMDGSFIER DPATIQIIPLLLIGLFVIRGGANFITQYGLKWVARRVVRDLREQMFCHLLALPARYYDQK ASGQLLAKLIYDVEQVSNAATDAILTIIRDSLTILGLLAWMAYLNGLLTLIILVTAPLIA LIIWWVSHRFRRISRKIQNSMGDVSQVAQETIEGHREVKIFGGQTYEAERFDQVNEQNRR QTMKMAATDAISQPVVQLIAVLGLAGVIHLATRESMLAQISVGTFISFITAMMLLLGPVK RLTKINGTLQRGIAAAQSIFGLLAETPEADRGQQSLRRARGAIRFEHLSFCYEPAKGPVL ENIDLEIKPYQTIALVGHSGSGKSTLVSLLARFYETTSGRILIDEMDIQTLRLTELRRQI ALVSQQIILFNDTIAHNIAYGSYQQTSKQDIIRAAEAAHAMEFINRLPDGLDTVIGEKGV LLSGGQRQRLAIARALLKDAPILILDEATASLDTEAERHIQAALETLMRQRTTLVIAHRL STVENADQIIVLHQGQIIERGTHSQLLARESHYAGLYRLQFRHSHEHVSPLSANVGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Noc_2675; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q3J7R8 |
◆ Recombinant Proteins | ||
Ereg-576M | Active Recombinant Mouse Ereg, Fc tagged | +Inquiry |
SLC1A6-6048Z | Recombinant Zebrafish SLC1A6 | +Inquiry |
TEKT2-4740H | Recombinant Human TEKT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EEF2K-3825H | Recombinant Human EEF2K Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fgf2-059M | Recombinant Mouse Fgf2 Protein | +Inquiry |
◆ Native Proteins | ||
ALP-8330C | Native Calf ALP | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
SAA-95H | Native Human Serum amyloid A | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
dsbA-8328E | Native E.coli dsbA | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fallopian-127C | Cynomolgus monkey Fallopian Tube Lysate | +Inquiry |
FUCA1-1212HCL | Recombinant Human FUCA1 cell lysate | +Inquiry |
OMP-1250HCL | Recombinant Human OMP cell lysate | +Inquiry |
IgG2-1610HCL | Recombinant Human IgG2 cell lysate | +Inquiry |
ACOT7-9087HCL | Recombinant Human ACOT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket