Recombinant Full Length Shewanella Sp. Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL6925SF |
Product Overview : | Recombinant Full Length Shewanella sp. Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q0HHH4) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MTASPKDEMWTVFKRLLGYLKPMKGMFLLSVCGLIVYGLVDAAFISFIGPFIDKGFSSST PAISNGIALPTSQGFHADNQVLLMAPIVVILMFSLRGFANFVSTYGISYMSARLIMDMRQ QVFEHYLSLPVSYMDKENTGNLISKVTFDTEQIARASGSALISIVRDGVTVIGMLGLMFY NSWKLSLCILVIGPIMGLVITIVSRRFRKVSKQIQTAMGDVSAATEQMIKGHKNVLAFGG QETETARFAKINDRNRHQNMKLAVAQAVSQPLIMVIGSFALAFVLYAASLDSMKADLTAG TFATILGAMMAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTLPESDTGTYTVKRAKGNL RFDNVSFSYEGQERRALDKIDFEVTQGQTLALVGRSGSGKSTIASLVTRFYTGLESGDIK LDDVSIYDYSLKSLRSQVALVSQQVTLFNDTIANNIAYAYPGEATREQIIQAATLAHAME FIEQLPEGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQQ GLDNLRQNRTSVVIAHRLSTIESADQILVVDQGRIVERGTHKSLLELGGMYAKLYQMQFG S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Shewmr4_2422; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q0HHH4 |
◆ Recombinant Proteins | ||
CHIT1-535H | Recombinant Human CHIT1 protein, His-tagged | +Inquiry |
BIVM-ERCC5-1308H | Recombinant Human BIVM-ERCC5 | +Inquiry |
NANOG-159H | Recombinant Human NANOG Protein, 13-residue TAT-tagged | +Inquiry |
RFL29577IF | Recombinant Full Length Influenza A Virus Matrix Protein 2(M) Protein, His-Tagged | +Inquiry |
RFL29247SF | Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ydr029W(Ydr029W) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FABP-178R | Native Rat Fatty acid Binding Protein | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALHM1-7892HCL | Recombinant Human CALHM1 293 Cell Lysate | +Inquiry |
SLITRK1-2847HCL | Recombinant Human SLITRK1 cell lysate | +Inquiry |
POU6F1-2997HCL | Recombinant Human POU6F1 293 Cell Lysate | +Inquiry |
SLC3A2-1772MCL | Recombinant Mouse SLC3A2 cell lysate | +Inquiry |
SURF1-1337HCL | Recombinant Human SURF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket