Recombinant Full Length Schizosaccharomyces Pombe Palmitoyltransferase Swf1(Swf1) Protein, His-Tagged
Cat.No. : | RFL26867SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Palmitoyltransferase swf1(swf1) Protein (O60069) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MDFFYKYLALVAIASLMVFILLFGQIPKLKYTVIGKLNRFFMVTIPYHLHVLDSRYADGR CSAAMRSLSNYVLYKNNPLVVFLYLALITIGIASFFIYGSSLTQKFSIIDWISVLTSVLL PYISLYIAAKSNPGKIDLKNWNEASRRFPYDYKIFFPNKCSTCKFEKPARSKHCRLCNIC VEKFDHHCIWINNCVGLNNARYFFLFLLCTIQLLFHSILRLGYHFNALRDMRQYPSFLRS WWFAIKSEGELGSVFLISLICSVLVLCLLGYEFFLVYAGYTTNESEKWSDLAHLVKNRKV YMYYENGSQLLALDKDASNDAILVTSMSQIDNIYDNGFYNNFFSLVFPYRHLYSTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | swf1 |
Synonyms | swf1; SPBC13G1.07; Palmitoyltransferase swf1 |
UniProt ID | O60069 |
◆ Native Proteins | ||
MPOB-234H | Native Human Myeloperoxidase Isoform B | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
HB-45R | Native Simian Hemoglobin (HB) Protein | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM57B-6364HCL | Recombinant Human FAM57B 293 Cell Lysate | +Inquiry |
FAM179B-902HCL | Recombinant Human FAM179B cell lysate | +Inquiry |
Spleen-865R | Mini Rabbit Spleen Membrane Lysate, Total Protein | +Inquiry |
SLC1A6-600HCL | Recombinant Human SLC1A6 lysate | +Inquiry |
MRPL33-4178HCL | Recombinant Human MRPL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All swf1 Products
Required fields are marked with *
My Review for All swf1 Products
Required fields are marked with *
0
Inquiry Basket