Recombinant Full Length Debaryomyces Hansenii Palmitoyltransferase Swf1(Swf1) Protein, His-Tagged
Cat.No. : | RFL13956DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii Palmitoyltransferase SWF1(SWF1) Protein (Q6BP23) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MSLPFTVIICIVLLSAILISIVIFGNSPNFRNTPIYKLRLKILRWNHDIIAWINYVDSHV FGNKLVFYSGWLVPLFYIIVVSFCLHQFFTKVYKLLPLFVRKSGFHSTYIAFTILCIFID TFMATFSNPGKITTGNVDKVDNFFQNNELIFFADNYCSTCEIIKPARSKHCSICNNCIML FDHHCIWVNNCVGYYNYKWFMGFLIANINLLGYGGYLCYQAMSSTKTEFPTLSYWKTIIS TNDSNKATGVLLILCVIFIMIAVLFTGLHLRYLYLGVTTNECDKWSEVEYLISLGSLYQV IDSNLNEKYVEKCVIMNHDNDSYETVFISLKNENVLFSSNDGINLRKIESMEDDLINIYD HGFVDNLKERMFNRVLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SWF1 |
Synonyms | SWF1; DEHA2E17138g; Palmitoyltransferase SWF1 |
UniProt ID | Q6BP23 |
◆ Recombinant Proteins | ||
ID3-28591TH | Recombinant Human ID3 | +Inquiry |
SIVA1-1519H | Recombinant Human SIVA1 Protein (1-110 aa), His-tagged | +Inquiry |
F-4533M | Recombinant Measles virus (strain Edmonston) F protein, His-tagged | +Inquiry |
RFL14885MF | Recombinant Full Length Mouse Lem Domain-Containing Protein 2(Lemd2) Protein, His-Tagged | +Inquiry |
Cep20-3068M | Recombinant Mouse Cep20 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIL3-2966HCL | Recombinant Human PPIL3 293 Cell Lysate | +Inquiry |
CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
Colon-82H | Human Colon Lupus Lysate | +Inquiry |
LGALS1-4770HCL | Recombinant Human LGALS1 293 Cell Lysate | +Inquiry |
ZBTB49-2042HCL | Recombinant Human ZBTB49 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SWF1 Products
Required fields are marked with *
My Review for All SWF1 Products
Required fields are marked with *
0
Inquiry Basket