Recombinant Full Length Yarrowia Lipolytica Palmitoyltransferase Swf1(Swf1) Protein, His-Tagged
Cat.No. : | RFL26644YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Palmitoyltransferase SWF1(SWF1) Protein (Q6CG20) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MWLKIYLLSILAISVFTFVFLFGALPQFEDTAVWKFRKWLSNRPAAIRSWDSKYCGGRLS VVGDFCGSVVAPAAPWSVPILYCAFTTYMFSAYYEDLHPFIAENHWYYAWLAPVAYTILV VSFVLATFSDPGKITKQNHALLLNQFRFDNLMFLEDTECSTCKFTKPARSKHDRFTNKCV AKFDHYCLWINNTVGLYNYRWFLFFLLGNVWTLCWGALLAGLKMIVMVAAEYKDHPKPLP SIFSQWWQVMITNENKRVGIIFLLSVSTGALACAFTAMHFYYIYLGATTNETDKWGDIHA AISEGSVWMFQKPGFKLDRSILLQKDEEGRPNRSLTAEEREYVAQNGLALTLLTDHKPIV NIYDKGFLNNLKAVMFPNSAY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SWF1 |
Synonyms | SWF1; YALI0B01606g; Palmitoyltransferase SWF1 |
UniProt ID | Q6CG20 |
◆ Recombinant Proteins | ||
PLSCR5-2153H | Recombinant Human PLSCR5 Protein, MYC/DDK-tagged | +Inquiry |
SAOUHSC-01699-3513S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01699 protein, His-tagged | +Inquiry |
ARFGAP3-309C | Recombinant Cynomolgus ARFGAP3 Protein, His-tagged | +Inquiry |
CHRNa7-3216R | Recombinant Rat CHRNa7 protein, His-tagged | +Inquiry |
Psma4-5174M | Recombinant Mouse Psma4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN14-02HCL | Recombinant Human CAPN14 HEK293T cell lysate | +Inquiry |
LMNB1-994HCL | Recombinant Human LMNB1 cell lysate | +Inquiry |
ATP5C1-8603HCL | Recombinant Human ATP5C1 293 Cell Lysate | +Inquiry |
CPM-2515HCL | Recombinant Human CPM cell lysate | +Inquiry |
SNTB2-1657HCL | Recombinant Human SNTB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SWF1 Products
Required fields are marked with *
My Review for All SWF1 Products
Required fields are marked with *
0
Inquiry Basket